All products are sold for Research Use Only. They are not drugs, foods, supplements, or cosmetics, are not approved by the FDA, and are not intended to diagnose, treat, cure, or prevent any disease, or for human or veterinary consumption. To continue you confirm that you are a qualified research professional aged 21 or older.
For research use only. Not for human or veterinary consumption. Not a drug, supplement, or food.
VIP, short for vasoactive intestinal peptide, is a 28-amino-acid neuropeptide that is widely studied in neuroscience, endocrinology, and receptor-signaling research. Synex Bio Labs supplies VIP as a lyophilized research peptide for in-vitro and laboratory use, with documentation so that researchers can verify identity and purity before starting work. This page explains what VIP is, how it is studied, what quality documentation to expect, and how to handle the material.
VIP is a linear peptide with the sequence His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2, with an amidated C-terminus. Its molecular weight is approximately 3,326 daltons [confirm from your COA]. It was first isolated from the intestine, and it is now known to be produced in many tissues, including the nervous system.
VIP belongs to a peptide family that includes PACAP, secretin, and glucagon. It acts mainly through two G-protein-coupled receptors, VPAC1 and VPAC2, and it can also interact weakly with the PAC1 receptor. Published literature is extensive and searchable on PubMed, and compound data is available on PubChem.
You may also see the synthetic version of VIP referred to as aviptadil in clinical-trial records. The VIP offered by Synex Bio Labs is sold strictly as a laboratory research material, and nothing on this page is a claim about effects in people.
VIP signals through receptors found in many tissues, which makes it a useful tool compound in several fields. In preclinical research, laboratories use VIP to examine:
Because VIP has a short half-life in biological systems, researchers also use it as a reference when evaluating longer-acting analogs.
| Specification | Detail |
|---|---|
| Product name | VIP (vasoactive intestinal peptide) |
| Class | 28-amino-acid neuropeptide, VPAC receptor agonist |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Molecular weight | ~3,326 Da [confirm from your COA] |
| Format | Lyophilized (freeze-dried) powder |
| Vial size | [e.g., 5 mg / 10 mg, confirm] |
| Purity (HPLC) | [state only your real figure from the COA] |
| Salt form | [e.g., acetate, confirm from COA] |
| Identity confirmation | [Mass spectrometry, confirm] |
| Storage | Store cold (freezer), dry, and protected from light [confirm against your COA] |
| Intended use | In-vitro and laboratory research only |
VIP is a mid-sized peptide, and its sequence creates specific quality risks. It contains a methionine residue that is prone to oxidation, and several asparagine and glutamine residues that can undergo deamidation, which shifts the mass by about one dalton. It has a strong tendency to stick to plastic and glass surfaces, and it can aggregate in solution. Any of these can reduce the amount of active peptide or change receptor activity, and a single purity figure will not reveal them. That is why VIP should come with documentation that shows identity as well as purity.
Synex Bio Labs supplies each lot of VIP with [a certificate of analysis. Describe your real process here, e.g., each lot is tested by an independent laboratory and the report is linked on this page]. A credible VIP COA should include:
HPLC tells you how pure the sample is, and mass spectrometry tells you whether it is the right molecule. You need both. Our guide on how to read a peptide COA (replace URL) explains what to look for, and you can use it to audit any VIP report you receive, from us or from any other supplier.
A purity percentage from HPLC reflects relative peak area at a single detection wavelength. It does not equal the share of the vial’s mass that is peptide, because water and counter-ions make up part of the powder. If your experiment depends on exact concentrations, as receptor assays usually do, ask for net peptide content and base your calculations on it rather than on the stated vial weight. This applies to VIP as it does to every lyophilized peptide.
VIP needs more careful handling than a short, stable peptide.
Treating handling as part of quality control protects the material you paid to have tested.
Researchers choosing a supplier for VIP should compare documentation, not marketing. At Synex Bio Labs we aim to provide:
If you are comparing suppliers, our peptide NCE supply guide (replace URL) walks through a complete vetting process.
This product is sold for in-vitro and laboratory research only. It is not intended for human or veterinary use, or for the diagnosis, treatment, or prevention of any condition, and it must not be used as a drug, food, or supplement. Regulatory status for VIP and its synthetic form, aviptadil, varies by country, and this product is not a pharmaceutical. By purchasing, you confirm that you are a qualified researcher or represent a research institution and that you will handle the material in line with applicable laws and your institution’s policies. Regulations change over time, so confirm current requirements for your region before ordering.
What is VIP? VIP is vasoactive intestinal peptide, a 28-amino-acid neuropeptide that acts on the VPAC1 and VPAC2 receptors. It is widely used in neuroscience and receptor-signaling research.
Is VIP the same as aviptadil? Aviptadil is the name used for the synthetic form of VIP in clinical-trial records. The VIP sold by Synex Bio Labs is a laboratory research material and is not a pharmaceutical product.
Is VIP approved for human use? Synex Bio Labs does not sell VIP for human use. It is supplied for laboratory research only and is not a medicine, supplement, or food.
What is the sequence and molecular weight of VIP? The sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, and the molecular weight is approximately 3,326 daltons. [Confirm against your COA.]
Why does VIP need special handling? It contains an oxidation-prone methionine, it can stick to plastic surfaces, and it can aggregate in solution. Aliquoting, low-binding labware, and cold storage help protect it.
What format does the VIP research peptide come in? It is supplied as a lyophilized powder in a sealed vial. [Confirm vial size and fill.]
Does VIP come with a certificate of analysis? [Yes, each lot ships with / links to a COA. State your real process.] The report should include HPLC and mass spectrometry data matched to your lot number.
External references: PubMed: vasoactive intestinal peptide, PubChem, ClinicalTrials.gov: aviptadil
All products are sold for in-vitro and laboratory research only. Not for human or veterinary use.
Yes. Every lot is independently third-party tested for identity and purity — ≥99% by HPLC and mass spectrometry — with a lot-matched Certificate of Analysis available to download on this page.
Yes. A lot-matched COA is available on this product page and in our COA library before purchase, documenting identity, purity, and full analytical results.
This product is supplied strictly for laboratory and research use only (RUO). It is not a drug, food, supplement, or cosmetic, is not approved by the FDA, and is not intended to diagnose, treat, cure, or prevent any disease, or for human or veterinary consumption.
Orders placed before 12pm CT typically ship the same business day from our U.S. facility with tracking. Store the lyophilized material at -20°C, protected from light and moisture.
